PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009619843.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 546aa    MW: 62390.2 Da    PI: 6.8866
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009619843.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.43.9e-19133179148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd +lv++vkq+G+++W+ Ia+ m  gR +kqc++rw+++l
   XP_009619843.1 133 KGQWTEEEDRKLVKLVKQFGMRRWAQIAENMV-GRAGKQCRERWHNHL 179
                      799*****************************.*************97 PP

2Myb_DNA-binding569.2e-18185227145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eE++ lv+a+kq G++ W+ Ia++++ gRt++ +k++w+
   XP_009619843.1 185 KDTWSEEEELMLVEAHKQIGNK-WAEIAKRIP-GRTENAIKNHWN 227
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.145128183IPR017930Myb domain
SMARTSM007171.7E-17132181IPR001005SANT/Myb domain
SuperFamilySSF466893.67E-30132226IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.1E-27134187IPR009057Homeodomain-like
CDDcd001677.74E-16136179No hitNo description
PfamPF139214.5E-19136195No hitNo description
SMARTSM007172.2E-16184232IPR001005SANT/Myb domain
PROSITE profilePS5129419.858184234IPR017930Myb domain
CDDcd001673.63E-12187230No hitNo description
Gene3DG3DSA:1.10.10.602.3E-20188232IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MEGGGGDRSA YQPFQNLPNN LPIFQQGPPL TAINRFLWSD QSQFSSQQNE SVFPHFYDFS  60
SYSNSASGSS SHEKVFSWTS FPEPGIFFNE QNSVRWNNQE NGIADEMISS EKNSKETGKK  120
AKQGASSTTV VVKGQWTEEE DRKLVKLVKQ FGMRRWAQIA ENMVGRAGKQ CRERWHNHLR  180
PDIKKDTWSE EEELMLVEAH KQIGNKWAEI AKRIPGRTEN AIKNHWNATK RRQNSRRNKL  240
KKQEKDGPNE SKYRRSNILQ DYIRSKYFSD DSPLTTNMTP MTNATPPYSD DDSPSLLTSQ  300
TYDEEMNFMQ NLFGRNSLME NNGKVLDNNS SYGFNSFGFN YSKNDNQSQD GCNLYLEPNM  360
YMADDQSYNS SDIYLSYLLD RTSTSATSLP YSGSFAYGNM MNQASSSSGG NNQVDLMEMI  420
KQVNSNLLFG RGPKRNKDKE VDVDSEPPTV NTIIPKHLNT VNDFQEKVPS ASLRTWAVSR  480
YPFSIRPSSI PIVKEDCNCP NLNILATDMI ERVTFAKEGT QWEPPRVQGL DRWVQKILEI  540
TTPESR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-431302331104C-Myb DNA-Binding Domain
1msf_C5e-431302331104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00567DAPTransfer from AT5G58850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754485e-37HG975448.1 Solanum pennellii chromosome ch09, complete genome.
GenBankHG9755215e-37HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619843.10.0PREDICTED: transcription factor MYB108-like
TrEMBLK4CA421e-121K4CA42_SOLLC; Uncharacterized protein
TrEMBLM1DRH71e-122M1DRH7_SOLTU; Uncharacterized protein
STRINGSolyc06g076840.1.11e-121(Solanum lycopersicum)
STRINGPGSC0003DMT4000932281e-122(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48251941
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.12e-71myb domain protein 119